pardaxin
National Institutes of Health
Papers overview
Semantic Scholar uses AI to extract papers important to this topic.
© 2015 TERRAPUB, Tokyo. All rights reserved. doi:10.5047/absm.2015.00801.0001 †Present address: Faculty of Biosciences and…
Antimicrobial peptides (AMPs) were recently determined to be potential candidates for treating drugresistant bacterial infections…
Tetraethylcneglycol diacrylate (4%)-crosslinked po ly styre ne has been used as solid support for peptide synthesis. This resi n…
The cytolytic activities and conformational properties of pardaxin (GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE), a 33-residue linear…
Abstract : Pardaxin, a marine neurotoxic polypeptide, isolated from the secretions of the flatfish Pardachirus marmoratus or…
Abstract : A new column chromatography procedure, based on gel-permeation, ion exchange and chromatofocusing was employed to…
1.Transport by the gill-like opercular epithelium of the teleost, Fundulus heteroclitus , was affected by pardaxin, a protein…