Skip to search formSkip to main content
You are currently offline. Some features of the site may not work correctly.

heterochromatin maintenance

The chromatin organization process that preserves heterochromatin in a stable functional or structural state. [GOC:mah]
National Institutes of Health

Papers overview

Semantic Scholar uses AI to extract papers important to this topic.
2018
2018
Distinct chromatin organization features, such as centromeres and heterochromatin domains, are inherited epigenetically. However… Expand
  • figure 1
  • table 1
  • figure 2
  • figure 3
  • figure 4
Is this relevant?
2017
2017
In addition to its proteolytic roles, the 26S proteasome is involved in regulating transcription and in promoting sites of active… Expand
  • figure 1
Is this relevant?
2014
2014
ABSTRACT In the fission yeast Schizosaccharomyces pombe, centromeric heterochromatin is maintained by an RNA-directed RNA… Expand
  • figure 1
  • figure 2
  • figure 3
  • figure 5
  • figure 6
Is this relevant?
Highly Cited
2012
Highly Cited
2012
Meiotic recombination is tightly regulated by cis- and trans-acting factors. Although DNA methylation and chromatin remodeling… Expand
  • table 1
  • figure 1
  • table 2
  • figure 2
  • figure 3
Is this relevant?
2012
2012
Eukaryotic chromosome ends have a DNA–protein complex structure termed telomere. Integrity of telomeres is essential for cell… Expand
  • figure 1
  • figure 2
  • figure 3
  • figure 4
  • figure 5
Is this relevant?
Review
2011
Review
2011
Defined as a chromatin structure that remains condensed throughout the cell cycle heterochromatin is generally transcriptionally… Expand
Is this relevant?
Highly Cited
2008
Highly Cited
2008
Posttranslational modification of histones is known to regulate chromatin structure and transcriptional activity, and the nuclear… Expand
  • figure 1
  • figure 2
  • figure 3
  • figure 5
  • figure 4
Is this relevant?
Highly Cited
2007
Highly Cited
2007
In maize (Zea mays ssp. mays), the meiotically heritable maintenance of specific transcriptionally repressed epigenetic states is… Expand
  • figure 1
  • figure 2
  • figure 3
  • table 1
  • figure 4
Is this relevant?
Review
2004
Review
2004
Heterochromatin maintenance is crucial for the clonal inheritance of cell identity, to ensure the proper segregation of… Expand
  • figure 1
  • figure 2
  • figure 3
Is this relevant?
2004
2004
  • MGKKTKRT-ADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHN MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN MGKKQNGK-SKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADN, ERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAF ARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISF ARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAF
  • 2004
  • Corpus ID: 207785297
In eukaryotic cells, the genetic material is organized into a complex structure that is known as chromatin (from the Greek khroma… Expand
  • figure 1
  • figure 2
  • figure 3
Is this relevant?