Skip to search formSkip to main content
You are currently offline. Some features of the site may not work correctly.

Cathelicidin LL-37, human

Known as: Antimicrobial Peptide, Human [LL-37, 37 aa], Cathelicidin LL-37, LL-37 
A synthetic form of a human antimicrobial peptide (37 amino acids), belonging to the cathelicidin family, with antimicrobial, anti-inflammatory… Expand
National Institutes of Health

Papers overview

Semantic Scholar uses AI to extract papers important to this topic.
Review
2018
Review
2018
Cathelicidins are host defense peptides with antimicrobial and immunomodulatory functions. These effector molecules of the innate… Expand
  • figure 1
  • figure 2
  • figure 3
  • figure 4
  • figure 5
Is this relevant?
Review
2018
Review
2018
This article reviews research results and ideas presented at a special symposium at the International Association of Gerontology… Expand
  • figure 1
  • figure 2
  • figure 3
  • table 1
  • figure 4
Is this relevant?
Review
2016
Review
2016
Antimicrobial peptides (AMPs) is a large family of compounds serving as natural antibiotics, widely distributed across the… Expand
Is this relevant?
Review
2004
Review
2004
  • M. Zanetti
  • Journal of leukocyte biology
  • 2004
  • Corpus ID: 14902156
Cathelicidins comprise a family of mammalian proteins containing a C‐terminal cationic antimicrobial domain that becomes active… Expand
Is this relevant?
Highly Cited
2003
Highly Cited
2003
Antimicrobial peptides are effector molecules of the innate immune system and contribute to host defense and regulation of… Expand
  • figure 1
  • figure 2
  • figure 3
  • figure 4
  • figure 5
Is this relevant?
Highly Cited
2003
Highly Cited
2003
The human cathelicidin anti-microbial protein, hCAP18 is a component of the innate immune system and has broad anti-microbial… Expand
Is this relevant?
Highly Cited
2001
Highly Cited
2001
Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. The known biologic… Expand
  • figure 2
  • table 1
  • figure 3
  • table 2
  • figure 4
Is this relevant?
Highly Cited
2000
Highly Cited
2000
We have previously shown that antimicrobial peptides like defensins have the capacity to mobilize leukocytes in host defense. LL… Expand
  • figure 1
  • figure 2
  • table I
  • figure 3
  • figure 4
Is this relevant?
Highly Cited
1998
Highly Cited
1998
The airway surface is an important host defense against pulmonary infection. Secretion of proteins with antimicrobial activity… Expand
  • figure 1
  • figure 2
  • figure 3
  • figure 4
  • figure 5
Is this relevant?
Highly Cited
1997
Highly Cited
1997
The epithelia constitute a major barrier to the environment and provide the first line of defense against invading microbes… Expand
  • table I
  • figure 2
  • figure 1
  • figure 3
  • figure 5
Is this relevant?