Cathelicidin LL-37, human

Known as: Antimicrobial Peptide, Human [LL-37, 37 aa], Cathelicidin LL-37, LL-37 
A synthetic form of a human antimicrobial peptide (37 amino acids), belonging to the cathelicidin family, with antimicrobial, anti-inflammatory… (More)
National Institutes of Health

Papers overview

Semantic Scholar uses AI to extract papers important to this topic.
Review
2009
Review
2009
The antimicrobial peptide LL-37 is the only known member of the cathelicidin family of peptides expressed in humans. LL-37 is a… (More)
  • figure 1
  • figure 2
Is this relevant?
Highly Cited
2003
Highly Cited
2003
Antimicrobial peptides are effector molecules of the innate immune system and contribute to host defense and regulation of… (More)
  • figure 1
  • figure 2
  • figure 3
  • figure 4
  • figure 5
Is this relevant?
Highly Cited
2002
Highly Cited
2002
The mast cell is one of the major effector cells in inflammatory reactions and can be found in most tissues throughout the body… (More)
Is this relevant?
Highly Cited
2002
Highly Cited
2002
The role of LL-37, a human cationic antimicrobial peptide, in the immune system is not yet clearly understood. It is a widely… (More)
  • table I
  • figure 1
  • figure 3
  • table II
  • figure 2
Is this relevant?
Highly Cited
2001
Highly Cited
2001
Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. The known biologic… (More)
  • figure 2
  • table 1
  • figure 3
  • table 2
  • figure 4
Is this relevant?
Highly Cited
2000
Highly Cited
2000
We have previously shown that antimicrobial peptides like defensins have the capacity to mobilize leukocytes in host defense. LL… (More)
  • figure 1
  • figure 2
  • table I
  • figure 3
  • figure 4
Is this relevant?
Highly Cited
2000
Highly Cited
2000
We identified antibacterial components in human T and natural killer (NK) cells by using freshly isolated lymphocytes enriched… (More)
Is this relevant?
Highly Cited
1998
Highly Cited
1998
Human neutrophils contain two structurally distinct types of antimicrobial peptides, beta-sheet defensins (HNP-1 to HNP-4) and… (More)
Is this relevant?
Highly Cited
1998
Highly Cited
1998
The airway surface is an important host defense against pulmonary infection. Secretion of proteins with antimicrobial activity… (More)
  • figure 1
  • figure 2
  • figure 3
  • figure 4
  • figure 5
Is this relevant?
Highly Cited
1997
Highly Cited
1997
The epithelia constitute a major barrier to the environment and provide the first line of defense against invading microbes… (More)
Is this relevant?