Modulation by LL-37 of the responses of salivary glands to purinergic agonists.

Abstract

The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A(2) (PLA(2)). The small release… (More)

Topics

10 Figures and Tables

Cite this paper

@article{Pochet2006ModulationBL, title={Modulation by LL-37 of the responses of salivary glands to purinergic agonists.}, author={St{\'e}phanie Pochet and S{\'e}verine Tandel and St{\'e}phanie Querri{\'e}re and Marie Tr{\'e}-Hardy and Mikel Garc{\'i}a-Marcos and Manuela De Lorenzi and Michel Vandenbranden and Aida Marino and Michel Jean Devleeschouwer and Jean-Paul Dehaye}, journal={Molecular pharmacology}, year={2006}, volume={69 6}, pages={2037-46} }