Isolation and characterization of a diuretic peptide common to the house fly and stable fly.

@article{Clottens1994IsolationAC,
  title={Isolation and characterization of a diuretic peptide common to the house fly and stable fly.},
  author={Frank L. Clottens and G. Mark Holman and Geoff M Coast and Nick F. Totty and Timothy K. Hayes and I. S. Kay and Anthony I. Mallet and Mark S. Wright and Josiben S Chung and Oanh Truong},
  journal={Peptides},
  year={1994},
  volume={15 6},
  pages={971-9}
}
An identical CRF-related diuretic peptide (Musca-DP) was isolated and characterized from whole-body extracts of the house fly, Musca domestica, and stable fly, Stomoxys calcitrans. The peptide stimulates cyclic AMP production in Manduca sexta Malpighian tubules and increases the rate of fluid secretion by isolated Musca domestica tubules. The 44-residue peptide, with a mol.wt. of 5180, is amidated, and has the primary structure: NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV-NH2. Musca-DP has a… CONTINUE READING