Engineering novel VPAC2-selective agonists with improved stability and glucose-lowering activity in vivo.

Abstract

A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were primarily poor stability in aqueous buffer and short duration of action in vivo. In this report, we describe a… (More)

Topics

7 Figures and Tables

Statistics

01020201520162017
Citations per Year

Citation Velocity: 5

Averaging 5 citations per year over the last 3 years.

Learn more about how we calculate this metric in our FAQ.