• Citations Per Year
Learn More
OBJECTIVE To describe the time point prevalence and distribution of all types of mental disorders in Hebei Province. METHODS From October 2004 to March 2005, stratified multi-stage cluster randomization was used to identify 24,000 subjects ≥18 years of age in Hebei Province. An expanded version of the General Health Questionnaire (GHQ-12) was used to(More)
The DNA-binding domain of the human transcription factor E2F1 was expressed in Escherichia coli. Through a single purification step using a Ni2+ column, 40-50 mg of the highly purified recombinant protein was obtained from 1 liter of bacterial culture. In addition, it was shown that the recombinant protein had higher stability and solubility under acidic(More)
The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149-178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and alphaH chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution.(More)
The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151-184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83-87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, alphaH(More)
The nonlinear absorptive property of a novel metal cluster [WS(4)Cu(3)I(4-bpy)3]n in DMF solution is studied by using an open-aperture Z-scan technique with picosecond and nanosecond laser pulses at the wavelength of 532 nm. The experimental results show that the cluster has strong nonlinear absorption under the 8 ns pulse excitation and a relatively weak(More)
  • 1