James P. Whelan

Learn More
The Gamblers' Beliefs Questionnaire (GBQ) is a self-report measure of gamblers' cognitive distortions. GBQ test items were constructed on the basis of theory, empirical evidence, and expert review. Four hundred three adults completed the initial set of items, and 21 items were selected to make up the final GBQ. The factor structure of the GBQ consisted of 2(More)
This project sought to identify adolescent outcome expectancies for gambling and to evaluate their relation to gambling behavior among a sample of urban adolescents. In a preliminary study, 50 outcome expectancies were identified on the basis of a literature review or generated after surveying 35 urban high school students. These expectancies were then(More)
Instruments to assess individuals' self-efficacy for the control of addictive behaviors have been useful for monitoring behavior change, predicting maintenance of treatment gains, and identifying potential relapse situations. The Gambling Self-Efficacy Questionnaire (GSEQ) was developed to assess perceived self-efficacy to control gambling behavior. A(More)
The present study considered the relation between adolescent gambling behavior and the perceived environment, the component of Jessor and Jessor's (1977) Problem Behavior Theory that assesses the ways that adolescents perceive the attitudes and behaviors of parents and peers. The predominantly African-American sample included 188 sophomores from two urban(More)
The Gambling Timeline Followback (G-TLFB), a measure of gambling behavior that uses the timeline followback methodology, was psychometrically evaluated with samples of frequent-gambling young adults. Seven dimensions of gambling behavior were assessed: type, frequency, duration, intent, risk, win-loss, and consumption of alcohol while gambling. The G-TLFB(More)
This laboratory study assessed the effectiveness of warning messages intended to aid in the control of gambling. Participants were 120 undergraduate students from an urban state university who reported previous gambling activity. They were recruited to play a computerized roulette game with imaginary money. Money left at the end of play was exchanged for(More)
A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were primarily poor stability in aqueous buffer and short duration of action in vivo. In this report, we describe a(More)
The psychometric properties of two pathological gambling (PG) screening instruments, the South Oaks Gambling Screen (SOGS) and the Massachusetts Gambling Screen-DSM-IV subscale (MAGS), were explored in a sample of college students (N = 159). Participants completed the two screening instruments, a diagnostic interview for PG, the Gambling-Timeline Followback(More)
OBJECTIVE The authors investigated behavioral indicators of pathological gambling in a college student sample. PARTICIPANTS AND METHODS The authors administered a diagnostic interview for pathological gambling to 159 college students, who also completed a demographic questionnaire, and a self-report measure of psychological distress. RESULTS Consistent(More)